Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00079.30
Common NameAMTR_s00079p00088960, LOC18432113
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 283aa    MW: 30697.6 Da    PI: 6.9668
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00079.30genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeA 65 
                                              +C++C+vlr++C+++C ++p++     p++q++++ +++k++G++ +++l++a p++ r+++++sl+yeA
                                              6********************************************************************* PP

                                   DUF260  66 earardPvyGavgvilklqqqleqlkaelallke 99 
                                              + r+ +P+yG+vg+++++++ql+q+++e++l ++
  evm_27.model.AmTr_v1.0_scaffold00079.30  74 CGRIVNPIYGSVGLLWSGSWQLCQAAVEAVLKGA 107
                                              ****************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.9273109IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-254103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006842288.10.0PREDICTED: LOB domain-containing protein 40
SwissprotQ9M8866e-84LBD41_ARATH; LOB domain-containing protein 41
TrEMBLW1P7Q50.0W1P7Q5_AMBTC; Uncharacterized protein
STRINGGLYMA18G53440.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4031699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.12e-83LOB domain-containing protein 41
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089